CD046_HUMAN Q504U0
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q504U0
Recommended name：Renal cancer differentiation gene 1 protein
EC number：
Alternative names：
Cleaved into：
GeneID：201725
Gene names (primary )：C4orf46
Gene names (synonym )：RCDG1
Gene names (ORF )：
Length：113
Mass：11899
Sequence：MADPEELQVSSPPPPPPSSPSSSDASAASSPGGPVSLGWPVPSRSSGPTVDQLEEVELQIGDAAFSLTKLLEATSAVSAQVEELAFKCTENARFLKTWRDLLKEGYDSLKPDD
Tissue specificity：Expressed in the kidney, in epithelial cells in both proximal tubules and distal convoluted tubules. {ECO:0000269|PubMed:25059753}.
Induction：
Developmental stage：
Protein families：