LY66C_HUMAN O95867
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O95867
Recommended name：Lymphocyte antigen 6 complex locus protein G6c
EC number：
Alternative names：
Cleaved into：
GeneID：80740
Gene names (primary )：LY6G6C
Gene names (synonym )：C6orf24 G6C NG24
Gene names (ORF )：UNQ1947/PRO4430
Length：125
Mass：13821
Sequence：MKALMLLTLSVLLCWVSADIRCHSCYKVPVLGCVDRQSCRLEPGQQCLTTHAYLGKMWVFSNLRCGTPEEPCQEAFNQTNRKLGLTYNTTCCNKDNCNSAGPRPTPALGLVFLTSLAGLGLWLLH
Tissue specificity：Highly expressed at the leading edges of cells, on filopodia. {ECO:0000269|PubMed:17008713}.
Induction：
Developmental stage：
Protein families：