RMXL1_MOUSE   Q91VM5


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q91VM5

Recommended name:RNA binding motif protein, X-linked-like-1

EC number:

Alternative names:(Heterogeneous nuclear ribonucleoprotein G-like 1) (RNA binding motif protein, X chromosome retrogene)

Cleaved into:

GeneID:19656

Gene names  (primary ):Rbmxl1

Gene names  (synonym ):Rbmxrt

Gene names  (ORF ):

Length:388

Mass:42162

Sequence:MVEADRPGKLFIGGLNTETNEKALEAVFGKYGRIVEILLMKDRETNKSRGFAFVTFESPADAKDAARDMNGKSLDGKAIKVEQATKPSFESGRRGPPPPPRSRGPPRGLRGGSGGTRGPPSRGGYMDDGGYSMNFNMSSSRGPLPVKRGPPPRSGGPPPKRSTPSGPVRSSSGMGGRTPVSRGRDSYGGPPRREPLPSRRDVYLSPRDDGYSTKDSYSSRDYPSSRDTRDYAPPPRDYTYRDYSHSSSRDDYPSRGYGDRDGYGRDRDYSDHPSGGSYRDSYESYGNSRSAPPTRGPPPSYGGSSRYDDYSSSRDGYGGSRDSYSSSRSDLYSSGRDRVGRQERGLPPSMERGYPPPRDSYSSSSRGAPRGGGRGGSRSDRGGGRSRY

Tissue specificity:

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp