NEUT_HUMAN   P30990


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P30990

Recommended name:Neurotensin/neuromedin N [Cleaved into: Large neuromedin N

EC number:

Alternative names:(NmN-125); Neuromedin N(NN) (NmN); Neurotensin(NT); Tail peptide]

Cleaved into:Large neuromedin N (NmN-125); Neuromedin N (NN) (NmN); Neurotensin (NT); Tail peptide

GeneID:4922

Gene names  (primary ):NTS

Gene names  (synonym ):

Gene names  (ORF ):

Length:170

Mass:19795

Sequence:MMAGMKIQLVCMLLLAFSSWSLCSDSEEEMKALEADFLTNMHTSKISKAHVPSWKMTLLNVCSLVNNLNSPAEETGEVHEEELVARRKLPTALDGFSLEAMLTIYQLHKICHSRAFQHWELIQEDILDTGNDKNGKEEVIKRKIPYILKRQLYENKPRRPYILKRDSYYY

Tissue specificity:

Induction:

Developmental stage:

Protein families:Neurotensin family


   💬 WhatsApp