UHMK1_HUMAN   Q8TAS1


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q8TAS1

Recommended name:Serine/threonine-protein kinase Kist

EC number:EC:2.7.11.1

Alternative names:(Kinase interacting with stathmin) (PAM COOH-terminal interactor protein 2) (P-CIP2) (U2AF homology motif kinase 1)

Cleaved into:

GeneID:127933

Gene names  (primary ):UHMK1

Gene names  (synonym ):KIS KIST

Gene names  (ORF ):

Length:419

Mass:46546

Sequence:MAGSGCAWGAEPPRFLEAFGRLWQVQSRLGSGSSASVYRVRCCGNPGSPPGALKQFLPPGTTGAAASAAEYGFRKERAALEQLQGHRNIVTLYGVFTIHFSPNVPSRCLLLELLDVSVSELLLYSSHQGCSMWMIQHCARDVLEALAFLHHEGYVHADLKPRNILWSAENECFKLIDFGLSFKEGNQDVKYIQTDGYRAPEAELQNCLAQAGLQSDTECTSAVDLWSLGIILLEMFSGMKLKHTVRSQEWKANSSAIIDHIFASKAVVNAAIPAYHLRDLIKSMLHDDPSRRIPAEMALCSPFFSIPFAPHIEDLVMLPTPVLRLLNVLDDDYLENEEEYEDVVEDVKEECQKYGPVVSLLVPKENPGRGQVFVEYANAGDSKAAQKLLTGRMFDGKFVVATFYPLSAYKRGYLYQTLL

Tissue specificity:Widely expressed, with highest levels in skeletal muscle, kidney, placenta and peripheral blood leukocytes. {ECO:0000269|PubMed:12093740}.

Induction:

Developmental stage:Regulated in a cell-cycle dependent manner, with lowest levels during S phase and highest at G1 phase (at protein level). {ECO:0000269|PubMed:23419774}.

Protein families:Protein kinase superfamily, Ser/Thr protein kinase family


   💬 WhatsApp