SPNS2_MOUSE Q91VM4
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q91VM4
Recommended name：Protein spinster homolog 2
EC number：
Alternative names：
Cleaved into：
GeneID：216892
Gene names (primary )：Spns2
Gene names (synonym )：
Gene names (ORF )：
Length：549
Mass：58196
Sequence：MMCLECASAAAGGAEEEEADAERRRRRRGAQPGAGGSACCGARGVGGAGVVSADEEVQTLSGSVRRVPSGLPSIPSTPGCAAAAKGPSAPQPKPASLGRGRGAAAAILSLGNVLNYLDRYTVAGVLLDIQQHFGVKDRGAGLLQSVFICSFMVAAPIFGYLGDRFNRKVILSCGIFFWSAVTFSSSFIPQQYFWLLVLSRGLVGIGEASYSTIAPTIIGDLFTKNTRTLMLSVFYFAIPLGSGLGYITGSSVKQAAGDWHWALRVSPVLGMITGTLILILVPATKRGHADQLGGQLKARTSWLRDMKALIRNRSYVFSSLATSAVSFATGALGMWIPLYLHRAQVVQKTAETCNSPPCGAKDSLIFGAITCFTGFLGVVTGAGATRWCRLRTQRADPLVCAVGMLGSAIFICLIFVAAKTSIVGAYICIFVGETLLFSNWAITADILMYVVIPTRRATAVALQSFTSHLLGDAGSPYLIGFISDLIRQSTKDSPLWEFLSLGYALMLCPFVVVLGGMFFLATALFFLSDRAKAEQQVNQLVMPPASVKV
Tissue specificity：Expression is high in the lungs and liver, low in the lymph nodes, spleen and bone marrow, and very low but detectable in the thymus. {ECO:0000269|PubMed:22664872}.
Induction：
Developmental stage：
Protein families：Major facilitator superfamily, Spinster (TC 2.A.1.49) family