GBG3_MOUSE   P63216


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:P63216

Recommended name:Guanine nucleotide-binding protein G(I)/G(S)/G(O) subunit gamma-3

EC number:

Alternative names:

Cleaved into:

GeneID:14704

Gene names  (primary ):Gng3

Gene names  (synonym ):Gngt3

Gene names  (ORF ):

Length:75

Mass:8305

Sequence:MKGETPVNSTMSIGQARKMVEQLKIEASLCRIKVSKAAADLMTYCDAHACEDPLITPVPTSENPFREKKFFCALL

Tissue specificity:Abundantly expressed in brain. Low levels in testis.

Induction:

Developmental stage:

Protein families:G protein gamma family


   💬 WhatsApp