TDRG1_HUMAN Q3Y452
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:Q3Y452
Recommended name:Testis development-related protein 1
EC number:
Alternative names:
Cleaved into:
GeneID:
Gene names (primary ):TDRG1
Gene names (synonym ):
Gene names (ORF ):
Length:100
Mass:10472
Sequence:MKRREAVCAHRHFLGTGKPPHPLGRSIPVEPCPGLPAFAEVDLLSLLVPIKISSTPPSGSRLDPQIASSAFPGLGSLGGQDSSGSLVQRASCELESPYEL
Tissue specificity:Expressed in the testis but not in any other non-reproductive tissues (at protein level). Mainly located in spermatogenic cells in seminiferous tubules of adult testis. {ECO:0000269|PubMed:22123530}.
Induction:
Developmental stage:Undetectable in the fetal testis, shows the highest expression level in post-puberty testis, with the expression levels decreasing afterwards with aging. {ECO:0000269|PubMed:22123530}.
Protein families: