CIP1_HUMAN   Q9NPC3


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9NPC3

Recommended name:E3 ubiquitin-protein ligase CCNB1IP1

EC number:EC:2.3.2.27

Alternative names:(Cyclin-B1-interacting protein 1) (Human enhancer of invasion 10) (RING-type E3 ubiquitin transferase CCNB1IP1)

Cleaved into:

GeneID:57820

Gene names  (primary ):CCNB1IP1

Gene names  (synonym ):C14orf18 HEI10

Gene names  (ORF ):

Length:277

Mass:31544

Sequence:MSLCEDMLLCNYRKCRIKLSGYAWVTACSHIFCDQHGSGEFSRSPAICPACNSTLSGKLDIVRTELSPSEEYKAMVLAGLRPEIVLDISSRALAFWTYQVHQERLYQEYNFSKAEGHLKQMEKIYTQQIQSKDVELTSMKGEVTSMKKVLEEYKKKFSDISEKLMERNRQYQKLQGLYDSLRLRNITIANHEGTLEPSMIAQSGVLGFPLGNNSKFPLDNTPVRNRGDGDGDFQFRPFFAGSPTAPEPSNSFFSFVSPSRELEQQQVSSRAFKVKRI

Tissue specificity:Highly expressed in heart. Detected at intermediate levels in liver and kidney, and at low levels in placenta, brain and lung. {ECO:0000269|PubMed:12612082}.

Induction:

Developmental stage:

Protein families:


   💬 WhatsApp