EST2C_RAT O70631
We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.
UniProt:O70631
Recommended name：Acylcarnitine hydrolase
EC number：EC:3.1.1.28
Alternative names：ACH M1
Cleaved into：
GeneID：171118
Gene names (primary )：Ces2c
Gene names (synonym )：Ces2 Imported, Ces2l Imported
Gene names (ORF )：
Length：561
Mass：62,170
Sequence：MARKQPHSWLNAVLFGLLLILIHVWGQDSPESSSIRTTHTGQVRGKLDHVRDTKAGVHTFLGIPFAKAPVGPLRFAPPEDPEPWSGVRDGTSHPAMCLQNIDMLDEVGLTDMKMILSSIPMSEDCLYLNIYTPAHAHEGSNLPVMVCIHGGALVIGMASMCDGSLLAVNEDLVVVAIQYRLGVLGFFSTGDEHARGNWGYLDQVAALRWVQQNIAHFGGNPNRVTIFGVSAGGTSVSSHVISPMSQGLFHGAIMESGVALLPDLISETSETVSTTVAKLSGCEATDSETLVRCLRAKSGAEILVINKVFKMIPAVVDGEFLPRHPKELLASEDFHPVPSIIGVNTDEYCCTIPMVMGTAQIIKELSRENLQAVLKDTAAQMMLPPECGDLLMEEYMGNTDDPQTLQIQYAEMMGDFLFVIPALQVAHFQRSHAPVYFYEFQHAPSYFKNVRPPHVKADHADEVPFVFGSFFWGIKVDFTEEEKLLSRRMMKYWANFARHGNPNSEGLPYWPVLDHDEQYLQLDTQPAVDRALKARRLQFWTKTLPQKIQELNGAQKNHAEL
Tissue specificity：Expressed in liver, stomach and kidney. 1
Induction：
Developmental stage：
Protein families：