CCNE2_MOUSE   Q9Z238


We list detailed information on various proteins on this webpage, which EnkiLife references when developing protein-related products. The protein data is sourced from UniProt, and since UniProt updates its information periodically, the data on our webpage may not always be up-to-date or may contain inaccuracies. If you notice any errors while browsing, we warmly welcome your feedback. Additionally, if you have any suggestions regarding any aspect of our website, please feel free to share them with us. As a token of our appreciation, we will offer a free product or a discount voucher for purchases to scientists who provide feedback. Please contact us at Email: order@enkilife.com; to share your feedback and get your rewards.


UniProt:Q9Z238

Recommended name:G1/S-specific cyclin-E2

EC number:

Alternative names:

Cleaved into:

GeneID:12448

Gene names  (primary ):Ccne2

Gene names  (synonym ):

Gene names  (ORF ):

Length:404

Mass:46669

Sequence:MSRRSSRLQAKQHAQPNQPDSPQETQIIQAKKRKTAQDVKKRKEEITKKHQYEIRNCWPPVLSGGISPCIIIETPHKEIGTSDFSRFTNYRFKNLFINPSPLPDLSWACSQEVWQNMLQKENRYVHDKHFQVLHSDLEPQMRSILLDWLLEVCEVYTLHRETFYLAQDFFDRFMLTQKDVNKNMLQLIGITSLFIASKLEEIYAPKLQEFAYVTDGACSEVDILKMELNILKALKWELCPVTVISWLNLFLQVDAVKDVPKVLLPQYSQETFIQIAQLLDLCILAIDSLEFQYRILAAAALCHFTSIEVVKKASGLEWDDISECVDWMVPFVSVVKSVSPVKLKTFKKIPMEDRHNIQTHTNYLALLNEVNYVNIYRKGGQLSPVCNGGIMTPPKSTEKPPGKH

Tissue specificity:Highest levels in adult testis, thymus and brain. Lower levels in placenta, spleen and colon.

Induction:

Developmental stage:

Protein families:Cyclin family, Cyclin E subfamily


   💬 WhatsApp